General Information

  • ID:  hor006918
  • Uniprot ID:  P09240
  • Protein name:  Cholecystokinin
  • Gene name:  NA
  • Organism:  Mus musculus
  • Family:  Gastrin/cholecystokinin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
  • GO MF:  GO:0030424 axon; GO:0043203 axon hillock; GO:0043194 axon initial segment; GO:0030425 dendrite; GO:0005615 extracellular space; GO:0098982 GABA-ergic synapse; GO:0043025 neuronal cell body; GO:0043204 perikaryon; GO:0043195 terminal bouton
  • GO BP:  GO:0005184 neuropeptide hormone activity; GO:0005179 hormone activity; GO:0048018 receptor ligand activity
  • GO CC:  GO:1903999 negative regulation of eating behavior; GO:2000986 negative regulation of behavioral fear response; GO:0032099 negative regulation of appetite; GO:0007613 memory; GO:2000987 positive regulation of behavioral fear response; GO:0007586 digestion; GO:0001764 neuron migration; GO:0043065 positive regulation of apoptotic process; GO:0008284 positive regulation of cell population proliferation; GO:0014049 positive regulation of glutamate secretion; GO:0051901 positive regulation of mitochondrial depolarization; GO:0050731 positive regulation of peptidyl-tyrosine phosphorylation; GO:0031334 positive regulation of protein-containing complex assembly; GO:0007205 protein kinase C-activating G protein-coupled receptor signaling pathway; GO:0001836 release of cytochrome c from mitochondria; GO:0099538 synaptic signaling via neuropeptide; GO:0008542 visual learning; GO:0038188 cholecystokinin signaling pathway; GO:0007409 axonogenesis; GO:0042755 eating behavior

Sequence Information

  • Sequence:  QPVVPAEATDPVEQRAEEAPRRQLRAVLRPDREPRARLGALLARYIQQVRKAPSGRMSVLKNLQSLDPSHRISDRDYMGWMDFGRRSAEDYEYPS
  • Length:  95
  • Propeptide:  MKSGVCLCVVMAVLAAGALAQPVVPAEATDPVEQRAQEAPRRQLRAVLRTDGEPRARLGALLARYIQQVRKAPSGRMSVLKNLQSLDPSHRISDRDYMGWMDFGRRSAEDYEYPS
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life / Aliphatic Index: Aliphatic Index:
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA